*NEW* Download the SSL Manager v1.3 for Windows application

SSL Checker and Diagnostics Tool

Is this site running ssl and does it have the ssl certificate installed correctly?

Results for: romana.ru

generated at 2016-02-08 16:52:28 -0600 (click 'lookup' for realtime info)

>> click here for dns information about romana.ru

>> click here to be reminded when ssl expires for romana.ru

>> click here to visit https://romana.ru

Use the SSL Checker Tool to find out details about a site's ssl certificate. Webmasters can use this tool to assist in troubleshooting ssl installation.

Simply enter a url in the text box and click the 'lookup' button to get detailed, realtime information about a site's ssl certificate.

website, domain, or url


Valid Domain Name IP Resolves To 176.9.169.102

SSL Certificate

Common Name : www.brh.ru
Subject Alternative Names : www.brh.ru
Is Wildcard? : false
Is UCC/SAN/Multiple Domain? : false
Has Wildcard in SAN? : false
Issuer Name : Thawte DV SSL CA
Serial Number : 66:5b:8e:f4:7e:e5:48:2e:cc:49:df:11:b1:69:43:fa
SHA1 Thumbprint : 27:2D:17:89:ED:6B:91:1A:BF:8B:D4:81:99:A2:22:F7:D9:CF:16:00
Key Length :
Signature Algorithm : sha1WithRSAEncryption
Secure Renegotiation: Supported

This certificate does not use a vulnerable Debian key (this is good)

Correct : Certificate date is valid, valid from Nov 5 2013 and it expires Nov 5 2014 (274 days from today)

Incorrect : Certificate Name does not match hostname romana.ru


Subject : www.brh.ru
Valid from Nov 5 2013 to Nov 5 2014
Issuer Name : Thawte DV SSL CA



Subject : Thawte DV SSL CA
Valid from Feb 18 2010 to Feb 17 2020
Issuer Name : thawte Primary Root CA



Subject : thawte Primary Root CA
Valid from Nov 17 2006 to Dec 30 2020
Issuer Name : Thawte Premium Server CA

SSL Certificate is not trusted
The certificate is not signed by a trusted authority (checking against Mozilla's root store). If you bought the certificate from a trusted authority, you probably just need to install one or more Intermediate certificates. Contact your certificate provider for assistance doing this for your server platform.

Recent Queries:

peakon.com, simplysuja.com, dkt-riset.blogspot.com, 170.225.15.40, www.dvdx.club, funforallchannel.blogspot.com, njcreativeentertainment.com, www.new.friendite.com, www.emlaksatismerkezi.com, suretybond-bg.blogspot.com, jump.dokoya.com, happyvalentinesday2015ideas.blogspot.de, www.connectsong.com, lavenyablog.wordpress.com, teddydayimages.blogspot.com, lombok-vacation.com, chanon001.blogspot.com, www.wiedzakontrowersyjna.pl, mywordpresszon.blogspot.com, resepisteamboat.blogspot.my, colexio.de, www.bigrockcouponinfo.in, ymb.com.ua, cedartubs.soup.io, socialdental.ro, 52.87.252.238, www.bluehostcouponinfo.in, pengobatantbcparualami.wordpress.com, www.canonprintersupport.us, caracepatmengatasipenyakitlemahsyahwat.wordpress.com, gyansagarinstitute.com, drkhullarsdentalclinic.blogspot.in, www.agarwalmoverpacker.co.in, www.bestshopcollections.com, successmaximum1.blogspot.in, pokerace99.domino888.asia, www.aonesafepackers.in, chocolatedaymessages.blogspot.com, freelatest-movies-download.blogspot.in, punesonammehta.blogspot.in, www.starantenaparabola.com, sprulineplustablet.blogspot.com, msncustomersupportservicenumber.tumblr.com, xn--b1ag3bn2a.kz, www.mojpieknyogrod.pl, ashishsehgal.com, hack-into-sh.com, thecanuckmethodreviews.com, giftoffer.info, remote.hack-into-sh.com, obatkankerpayudarayangmenyerangketulang.wordpress.com, blog.audiosolutionz.com, gamestaff.net, www.pineapplehr.com, maswahyublogger.blogspot.com, www.aonesafepackers.com, planetbetng.wordpress.com, kanopibajaringan.top, torreypinestowncar.wordpress.com, zagrebsecurityforum.com, nlpintensive.in, www.addpoll.com, att.yahoo.com, sedot-wc-jakartaselatan.blogspot.co.id, kingblazers.com, jonsonjay9.edublogs.org, a007access.blogspot.in, munggahgunungyo.blogspot.co.id, www.dayapramana.com, monikachiang.wordpress.com, kampanye2019.blogspot.co.id, analogmusic.bloggplatsen.se, tokoagaricproherbal.blogspot.co.id, obatkuatpria.alternatifpengobatan.com, www.executiverecruitmentsindia.com, www.millennialgen.biz, www.azkini.com, resepinasigorengkampung.blogspot.my, www.vimaxdistributor76.blogspot.co.id, localpackersandmoversbangalore.in, www.atozmp4.in, www.yachts-boat.com, www.internetmarketingexpertsnewcastle.com.au, superpowervx.org, outboundselectamalang.wordpress.com, www.creative-documents.com, negocioformulaonline.wordpress.com, pedreiroepintor.com.br, volpino.ru, tricoretrade.com.au, www.gazzettaweb.net, makananyangmampumenambahtrombosit.blogspot.com, vigpowerhasbiherbal.blogspot.com, www.techies4u.com, www.redecineshow.com.br, groovysunglasses.co, slingbagkumurah.blogspot.co.id, gejalakehamilananakpertamadirasakan.blogspot.com, www.wordpressplugins.pl, enciclopediadelamor.blogspot.com.co