*NEW* Download the SSL Manager v1.3 for Windows application

SSL Checker and Diagnostics Tool

Is this site running ssl and does it have the ssl certificate installed correctly?

Results for: mygrafiks.be

generated at 2016-02-09 07:39:40 -0600 (click 'lookup' for realtime info)

>> click here for dns information about mygrafiks.be

>> click here to be reminded when ssl expires for mygrafiks.be

>> click here to visit https://mygrafiks.be

Use the SSL Checker Tool to find out details about a site's ssl certificate. Webmasters can use this tool to assist in troubleshooting ssl installation.

Simply enter a url in the text box and click the 'lookup' button to get detailed, realtime information about a site's ssl certificate.

website, domain, or url


Valid Domain Name IP Resolves To 213.186.33.48

SSL Certificate

Common Name : ssl12.ovh.net
Subject Alternative Names : ssl12.ovh.net
Is Wildcard? : false
Is UCC/SAN/Multiple Domain? : false
Has Wildcard in SAN? : false
Issuer Name : AlphaSSL CA - G2
Serial Number : 11:21:c5:1e:ff:2b:76:70:0f:9f:a3:c5:9a:70:98:38:49:e2
SHA1 Thumbprint : C4:8D:B9:CE:81:2D:7F:DC:FB:F9:87:F4:93:41:7D:3A:66:69:5D:FC
Key Length :
Signature Algorithm : sha1WithRSAEncryption
Secure Renegotiation: Supported

This certificate does not use a vulnerable Debian key (this is good)

Correct : Certificate date is valid, valid from May 14 2013 and it expires May 14 2016 (832 days from today)

Incorrect : Certificate Name does not match hostname mygrafiks.be


Subject : ssl12.ovh.net
Valid from May 14 2013 to May 14 2016
Issuer Name : AlphaSSL CA - G2



Subject : AlphaSSL CA - G2
Valid from Apr 13 2011 to Apr 13 2022
Issuer Name : GlobalSign Root CA



Subject : GlobalSign Root CA
Valid from Sep 1 1998 to Jan 28 2028
Issuer Name : GlobalSign Root CA

SSL Certificate is not trusted
The certificate is not signed by a trusted authority (checking against Mozilla's root store). If you bought the certificate from a trusted authority, you probably just need to install one or more Intermediate certificates. Contact your certificate provider for assistance doing this for your server platform.

Recent Queries:

job-eor-99.blogspot.com, stone-group-africa.mycylex.com, www.osegredoparaosucesso.com.br, www.hphealthnavigators.com, crystalxnews.blogspot.co.id, whirldroid.com, www.climatizadoresevaporativos.com, www.silvashaw.co.za, www.boko.pl, altinkum.co.uk, top200.gs, tulikajain.com, www.reactboom.blogspot.com, bicycleinfo.info, laneguide.se, jayaticreative.com, ishaansports.blogspot.com, dedetizadorablog.wordpress.com, suryaperdanakediri.blogspot.co.id, www.yuknonton.com, tamadansk.ru, talad.hn.org, dollartab.com, www.cheap-accountants-in-london.co.uk, ocpremierluxuryrealestate.com, stafrica.blogspot.co.za, www.ebcwebstore.com, rajaramuan.blogspot.com, goldtrademicrosystem.com, ishaansports.wordpress.com, teradatariver.com, xn--80ajjhbcqhrt1j.com.ua, webhostingc.com, www.buildyourmoneyfast.com, dating.thegoldenbillion.com, www.thetechpartnership.com, carsmall.ru, asbestosremovalservice.blogspot.com.au, 188.165.199.161, thecanuckmethod.org, fullentertainmentmzaa.com, www.aamhimaratha.com, autodealer.ee, dkt-forex.blogspot.com, ukuttarakhand.com, www.futureplansnews.com, www.cartridgepeople.com, theinducers.blogspot.in, denys.pl, smiatek.name, www.robiewesele.pl, www.pyramidenterprise.com, dkt-asuransi.blogspot.com, remote.masonpearson.com, whiteteacuppuppies.com, bfifinance9292.blogspot.co.id, mail.bsd.ricoh.co.th, offerscheckie.doodlekit.com, peakon.com, simplysuja.com, dkt-riset.blogspot.com, 170.225.15.40, www.dvdx.club, funforallchannel.blogspot.com, njcreativeentertainment.com, www.new.friendite.com, www.emlaksatismerkezi.com, suretybond-bg.blogspot.com, jump.dokoya.com, happyvalentinesday2015ideas.blogspot.de, www.connectsong.com, lavenyablog.wordpress.com, teddydayimages.blogspot.com, lombok-vacation.com, chanon001.blogspot.com, www.wiedzakontrowersyjna.pl, mywordpresszon.blogspot.com, resepisteamboat.blogspot.my, colexio.de, www.bigrockcouponinfo.in, ymb.com.ua, cedartubs.soup.io, socialdental.ro, 52.87.252.238, www.bluehostcouponinfo.in, pengobatantbcparualami.wordpress.com, www.canonprintersupport.us, caracepatmengatasipenyakitlemahsyahwat.wordpress.com, gyansagarinstitute.com, drkhullarsdentalclinic.blogspot.in, www.agarwalmoverpacker.co.in, www.bestshopcollections.com, successmaximum1.blogspot.in, pokerace99.domino888.asia, www.aonesafepackers.in, chocolatedaymessages.blogspot.com, freelatest-movies-download.blogspot.in, punesonammehta.blogspot.in, www.starantenaparabola.com, sprulineplustablet.blogspot.com