*NEW* Download the SSL Manager v1.3 for Windows application

SSL Checker and Diagnostics Tool

Is this site running ssl and does it have the ssl certificate installed correctly?

Results for: little-extra.fr

generated at 2016-05-05 12:14:46 -0500 (click 'lookup' for realtime info)

>> click here for dns information about little-extra.fr

>> click here to be reminded when ssl expires for little-extra.fr

>> click here to visit https://little-extra.fr

Use the SSL Checker Tool to find out details about a site's ssl certificate. Webmasters can use this tool to assist in troubleshooting ssl installation.

Simply enter a url in the text box and click the 'lookup' button to get detailed, realtime information about a site's ssl certificate.

website, domain, or url


Valid Domain Name IP Resolves To 193.109.250.113

SSL Certificate

Common Name : aietrainingmaterials.auchan.com
Subject Alternative Names : aietrainingmaterials.auchan.com, apollo.auchan.com, apolloreport.auchan.com, appauchan-store.auchan.com, auchan-c-nous.auchan.com, avizedeplata.auchan.ro, basics.auchan.com, blogsdsio.auchan.com, cas.auchan.com, casqualif.auchan.com, creapub.auchan.com, docsdsio.auchan.com, download.auchan.com, downloadd2.auchan.com, downloadd3.auchan.com, ecards.auchan.com, englobe.auchan.com, eureka.auchan.com, eurekamedia.auchan.com, expats.auchan.com, expatsdocs.auchan.com, extractionportailpartenaire.auchan.com, governis.auchan.com, gtweb.auchan.com, im.auchan.com, indicateursrhgroupe.auchan.com, itwebanalytics.auchan.com, little-extra.fr, mobilite.auchan.com, payments.auchan.ru, planet-treso.auchan.com, portail-partenaire.auchan.com, portailpartenaire.auchan.fr, premiummail.auchan.fr, purchasing.auchan.com, qualitycenter.auchan.com, rapid.auchan.com, reactif.petrovex.com, reglement.auchan.fr, reglements.auchan.lu, rvf.auchan.com, szallito.auchan.hu, talent-recrut.auchan.fr, talkshow.auchan.com, traceability.auchan.com, transport.auchan.fr, txtchain-ahm.auchan.com, txtchain-cn.auchan.com, txtchain.auchan.com, txtdrive-cn.auchan.com, valauchan-elections.auchan.fr, valauchan-souscription.auchan.fr, valauchan.auchan.fr, valsuper.fr, webmail.auchan.com, webmail.auchan.fr, webmail.auchan.ru, what-elles.auchan.com, ws-itweb.auchan.com, www.auchanproduction.auchan.com, www.auchanproductioncatalog.com, www.blogauchandrive.fr, www.businesstravel.auchan.com, www.eti.auchan.com, www.fioul.auchan.fr, www.ilo.auchan.com, www.petrovex.com, xfile.auchan.com, xfile.auchan.fr, xfiled2.auchan.com, xfiled3.auchan.com, zpush.auchan.com
Is Wildcard? : false
Is UCC/SAN/Multiple Domain? : true
Has Wildcard in SAN? : false
Issuer Name : TBS X509 CA pro hosting
Serial Number : 03:a2:f5:b2:ba:1e:4b:cc:c3:8d:bf:2a:f3:dc:5b:c9
SHA1 Thumbprint : D0:0F:54:DC:19:76:E3:66:20:DF:FC:16:C5:6F:CC:FB:61:06:6A:90
Key Length :
Signature Algorithm : sha1WithRSAEncryption
Secure Renegotiation: Not Supported

This certificate does not use a vulnerable Debian key (this is good)

Correct : Certificate date is valid, valid from Dec 13 2013 and it expires Aug 3 2014 (165 days from today)

Correct : Certificate Name matches hostname little-extra.fr


Subject : aietrainingmaterials.auchan.com
Valid from Dec 13 2013 to Aug 3 2014
Issuer Name : TBS X509 CA pro hosting



Subject : TBS X509 CA pro hosting
Valid from Dec 1 2005 to Jun 24 2019
Issuer Name : AddTrust External CA Root



Subject : AddTrust External CA Root
Valid from Jun 7 2005 to Jun 24 2019
Issuer Name : UTN - DATACorp SGC



Subject : UTN - DATACorp SGC
Valid from Jun 24 1999 to Jun 24 2019
Issuer Name : UTN - DATACorp SGC

SSL Certificate is correctly installed
Congratulations! This certificate is correctly installed.

Recent Queries:

mhgd520.com, majordepot.com, latestkikusernames.blogspot.com, gb.enrollbusiness.com, kneadinghopemassage.com, porndemy.com, golfmk7.co.uk, cratoez.blogspot.com, kitchenarts.com, nogmoyoga.com, bestpowor.ru, parcriviera.net, whholidays.com, russianstars.xxxlog.co, 2rrent.millions35.hop.clickbank.net, kmetija-cerne.si, www.blaadi.com, obat-penggugur.com, dsltuition.co.uk, spanishstars.xxxlog.co, www.gospelwater.org, blogok.millions35.hop.clickbank.net, modelsis.sn, shangdecorandmore.com, tchatdelire.fr, oyster.ignimgs.com, dragonballzdokkanbattleastuce.wordpress.com, www.downloadlivre.net, qas-fr.store.mt.com, qas-uk.store.mt.com, qas-si.partner.store.mt.com, qas-mton.store.mt.com, qas-us.store.mt.com, qas-nl.store.mt.com, qas-ch.store.mt.com, qas-us.partnershop.ohaus.com, qas-fr.shoprainin.com, qas-ca.store.mt.com, www.hagadineroencasa.com, www.elmalekcars.com.eg, hoobasandos.weebly.com, te3n.box-office-collection.in, test-us.partner.store.mt.com, www.pornxxxvideo.sex, www.studiojeden.pl, kudliak.com.ua, michelineturley42.soup.io, liberty-company.ru, ravindrasahu.com, alanwongphotography.tumblr.com, googleweblight.com, eventhorizonofficial.com, hikaripark.ntt-east.co.jp, us.ntt.com, th.ntt.com, hk.ntt.com, eu.ntt.com, support.ntt.com, sg.ntt.com, www.currencyexchangekanata.ca, korakod.edublogs.org, hotindianmasti.blogspot.com, nimac.org.cy, www.lavishprive.com, www.ordinaryguyfitness.com, jaddenyap.wordpress.com, avastpremierlicensekeycrackserial.blogspot.ro, jasafotografijakartaa.wordpress.com, 3nadl.com, leconsultantci.com, ijcdr.net, lookatju.com, www.greaterlondondating.com, local.316taxi.info, msitpros.com, www.lefthandshake.org, bestcv.duckdns.org, pelangsingherbal1.wordpress.com, www.zubeezone.com, mailingproject.net, 3dproprinters.com, canudeirosbr.blogspot.com.br, printmachine.ca, shop.louisekorner.com, 39westpress.com, www.premiercardoffer.net, www.resume32.duckdns.org, www.criacaodesitesesistemas.com.br, www.elogic.md, roymassivemarketplaceworldclassdiywebsit.soup.io, web3.greenpowermonitor.com, legendclubltd.com, jobsection.info, www.ecofarm.com.br, results.choicelab.net, mikeyeshwastrol.flavors.me, www.news-recap.net, www.kayeswain.com, www.botanicalprintsshop.com, millenniumproperty.blogspot.my