*NEW* Download the SSL Manager v1.3 for Windows application

SSL Checker and Diagnostics Tool

Is this site running ssl and does it have the ssl certificate installed correctly?

Results for: didid-cracker.blogspot.com

generated at 2015-03-26 18:39:22 -0500 (click 'lookup' for realtime info)

>> click here for dns information about didid-cracker.blogspot.com

>> click here to be reminded when ssl expires for didid-cracker.blogspot.com

>> click here to visit https://didid-cracker.blogspot.com

Use the SSL Checker Tool to find out details about a site's ssl certificate. Webmasters can use this tool to assist in troubleshooting ssl installation.

Simply enter a url in the text box and click the 'lookup' button to get detailed, realtime information about a site's ssl certificate.

website, domain, or url


Valid Domain Name IP Resolves To 74.125.228.74

SSL Certificate

Common Name : *.googleusercontent.com
Subject Alternative Names : *.googleusercontent.com, *.blogspot.com, *.bp.blogspot.com, *.commondatastorage.googleapis.com, *.doubleclickusercontent.com, *.ggpht.com, *.googledrive.com, *.googlesyndication.com, *.storage.googleapis.com, blogspot.com, bp.blogspot.com, commondatastorage.googleapis.com, doubleclickusercontent.com, ggpht.com, googledrive.com, googleusercontent.com, static.panoramio.com.storage.googleapis.com, storage.googleapis.com
Is Wildcard SSL? : true
Is UCC SSL/SAN SSL? : true
Has Wildcard domain in SAN field? : true
Issuer Name : Google Internet Authority G2
Serial Number : 5264976863735628432
SHA1 Thumbprint : D2:C4:0E:8C:46:FF:EF:3B:E1:47:88:DC:87:CF:D3:E0:46:74:C0:F2
Key Length :
Signature Algorithm : sha1WithRSAEncryption
Secure Renegotiation: Supported

This certificate does not use a vulnerable Debian key (this is good)

Correct : Certificate date is valid, valid from Mar 12 2014 and it expires Jun 10 2014 (81 days from today)

Correct : Certificate Name matches hostname didid-cracker.blogspot.com


Subject : *.googleusercontent.com
Valid from Mar 12 2014 to Jun 10 2014
Issuer Name : Google Internet Authority G2



Subject : Google Internet Authority G2
Valid from Apr 5 2013 to Apr 4 2015
Issuer Name : GeoTrust Global CA



Subject : GeoTrust Global CA
Valid from May 21 2002 to Aug 21 2018
Issuer Name : Equifax

SSL Certificate is correctly installed
Congratulations! This certificate is correctly installed.

Recent Queries:

www.redtotal.mx, www.ftsaude.com.br, sanjoseviajes.blogspot.com, easymall.in, www.a2zcinemanews.com, www.houstonconcretestaining.com, vinhxuanhtx.com, www.minaturallyskincare.com, www.motorcycleguidespecs.blogspot.com, www.cpahkcompanyformation.com, tr.thebookmarkmagazine.com, personalinjurylawyermichigan2015.blogspot.com, nailfreaks.nl, obattipesuntukanakyangampuh.wordpress.com, www.tesla-motors-review.weebly.com, www.komunitasrumahsehat.com, obatstrokealamiaman.blogspot.com, glozoetherapist.blogspot.com, obatpenyakitkistatradisional.blogspot.com, orderobatacemaxs.blogspot.com, herbaldanalami21.blogspot.com, deplump.com, footballshirtspassion.com, suckhoecchotoanthecongdong.blogspot.com, obatbatuginjalalamisite.blogspot.com, jihanobatjerawat.wordpress.com, socialogs.net, obatglaukoma03.blogdetik.com, evangelistasepastores.blogspot.com.br, caramengobatikistarahimsampai100.wordpress.com, pypengobatanalami.blogspot.com, caracepatmengatasigerd.wordpress.com, harmoniherbalalami19.blogspot.com, smpn1menganti.sch.id, naturalcuresforvaginallooseness.wordpress.com, gcart.mobi, pusatkonveksimurahh.wordpress.com, rxusa.com, www.xdownfiles.blogspot.com.br, produkgreenworldsite.blogspot.com, griyaqu.weebly.com, www3.amcompliance.us, wwws.amcompliance.us, app.amcompliance.us, www.lotionaeuko.net, caramengobatikistarahimsecarapermanen.wordpress.com, unitasisac.ie, www.ncha.com.au, caradietsehattanpaefeksamping.wordpress.com, www.reading4all.clinicalresearcher.net, clbthietbiyte.com, gamertoolkits.blogspot.com, 167.114.12.134, jualobataborsi888.blogspot.com, www.duongvatgia.biz, www.chefrobertmontgomery.com, www.clinicalresearcher.net, www.kafkasanaari.com, thegioichieusang.com, obat55.gov7.net, trikkomputer89.blogspot.com, obataborsicilacap.blogspot.com, parnis-uhren.de, yoga-rhythms.com.au, masteractivatorrevolutionpdf.wordpress.com, www.nossosait.blogspot.com.br, clearlycatalina.com, 60waystoloseweight.blogspot.com, flatabsforlifepdf1.wordpress.com, pasangiklanjakarta.com, www.cilacaphosting.co.id, www.conaexh.weebly.com, tropicalfishtanksblog.com, www.drivesheet.blogspot.com, www.loveporntube.com, strokiknig.ru, femmestyle.name, singlewardrobes.co.uk, geranoi-thessaloniki.puzl.com, staceymalleck.com, www.melhores-franquia.weebly.com, www.xaydunganphuoc.com, westernunionbyr.wordpress.com, fortuneads.com, alingshop.wordpress.com, ava-addams-milf.blogspot.com, manziltv.blogspot.com, decora.bnx.pl, timebooks.website, keepin-katz.co.nz, pozyczki247.wallinside.com, milatdizisiizle.wordpress.com, socialbookmarkingnet.asia, www.the4csolution.com, practic.childpsy.ru, freelivexxxcams.wordpress.com, preventis-dz.com, cadhost.co, files.sparkfl.com, dev.tbiraft.com